IOTA Criptomoneda para el Internet of Things (IoT)


#1

Iota es un novedoso token para microtransacciones optimizado para el Internet-of-Things[Internet de las cosas - IoT] A diferencia de los blockchains complejos y pesadas de Bitcoin y similares, que fueron diseñados con otros fines en mente, Iota se he creado para ser lo más ligera posible, de ahí el nombre de “Iota” con énfasis en la parte ‘IOT’. Ha sido desarrollada por David Sønstebø, Mathcl y Come-from-Beyond , quién se rumorea era también BCNext, creador de Nxt.



Miembros de la fundación IOTA anunciados:

https://bitcointalk.org/index.php?topic=1216479.0
http://www.iotatoken.com/

:fire: :fire: :fire: https://www.queesiota.info/ :fire: :fire: :fire:


Trading para novatos: Teoría y practica
Servidor para IOTA- light wallet , por forobits
Como funciona billetero en el movil-ayuda a novatos
[BITCOIN] Cotización Bitcoin, seguimiento del precio (No AT)
Servidor para IOTA- light wallet , por forobits
[IOTA] Análisis Técnico
IotaSupport en español
[IOTA] Análisis Técnico
#2

Se han cansado ya de dar largas con Jinn, y sacan IOTA. Habrá algo de hype y pump seguro.


#3

Es verdad que Jinn como inversión pinta mal, o bien y han querido quitarse responsabilidades xD.
Espero que se porten con los tenedores de Jinn en el cambio a IoTA, porque Jinn con lo dicho parece no tener mucho sentido, y dan largas con los objetivos/funcionamiento del asset…
Al desaparecer toda la presión compradora porque ya no tendrá sentido comprar Jinn, el precio del asset solo puede ir para abajo. Y si tan a largo plazo es ese asset, se podrá recomprar mucho más abajo… Sólo veo que ese asset va a pasar a tener 0 valor y 0 opciones sobre lo que genere Jinn porque irá quedando en el olvido.

https://nxtforum.org/news-and-announcements/(ann)-jinn/msg197270/#msg197270

UPDATE

PART 1: JINN Reality check

We have registered that a lot of JINN token holders are confused about what Jinn really is and/or what JINN tokens represent. This has lead to a lot of speculation into why the development is so ‘slow’ as well as good old speculators pumping for profit and trolls playing on fear, so here is a large dose of reality:

Jinn is a semiconductor start-up developing perhaps the most unorthodox general purpose processor for commercial use ever. Ternary has not seen physical implementation since Soviet 1970 and asynchronous processors have only been developed a handful of times, primarily in research laboratories decade(s) ago. The combination of both ternary and asynchronous has never even been attempted before Jinn. It’s important to understand that Jinn is primarily hardware, not software. In software projects you can put together a prototype/proof of concept/minimum-viable-product in days, weeks or months on a small or even non-existent budget. In the hardware microprocessor research and development realm this is not so. We are not just dealing with code (though we do that too for compiler, emulator and the necessary custom tools), but actual electrical engineering. This means that even if our processor was a run of the mill type without any exotic tech, it would still be a lengthy and very expensive process. To put all of this into perspective consider 21.co which developed a processor/ASIC in regular synchronous binary architecture on a ~120 million dollar budget. Even with this funding it still took them a long while, even while teamed up with one of the leading semiconductors in the world (Qualcomm).

If you ask pretty much any person with knowledge about this industry and technology, they will give Jinn a very low estimate of success, hence why we labelled this a HIGH RISK project from day 1. Also listed in our project outline was the potential problem of volatility and illiquidity of nxt tokens pooled together for this project. As Murphy would have it, this happened and we lost over 50% of our already microscopic resources (in the context of the semiconductor industry). On top of this we lost a few months of time due to early employees having to be let go due to not meeting obligations, such is start-up life. Add to this that the semiconductor venture capital environment is one of the least friendly, precisely due to the immense overhead hardware projects have. It’s much easier to pour funds into software which costs little to develop and has potential for massive return on investment. In short: this is still very much long term and high risk.

The last issue we need to address is this idea that seems to have just emerged out of nowhere over the last weeks. It seems someone started claiming that JINN tokens represent equity in the company we’re building. It does not. Jinn + Jiniri is the processor + emulator project in our company, we never issued equity in said company, we couldn’t even if we wanted to for legal reasons. JINN tokens, like we specified from day 1, will receive tokens directly from the sales of Jinn processor and Jiniri Unlimited subscriptions.

With all that being said and hopefully sufficiently clarified, we are still moving full steam ahead with Jinn, but it will still be a long time before it yields any ‘dividends’ via JINN tokens, if ever. If this iteration fails for whatever reason, we will have to begin from scratch and do a complete new fundraiser. This is just brutal reality that everyone needs to be aware of. Like we have said all along: JINN tokens are high risk and do not represent equity in Jinn. The hardware industry is A LOT more time-consuming and less forgiving than the software industry. Sadly, but predictably, there are a lot of people who benefit handsomely by hyping JINN tokens every time we make any kind of announcement, which is why we have done everything in our power to keep all info under the veil and limit the updates to only the concrete info we have.

While this might be sobering news for some of you, there is good news too!
We are extremely grateful for any and every person that has and continues to support the Jinn project in any fashion. It is very important for us that everyone that was part of the initial fundraiser is making their choices based on facts and not hype. So due to this unfounded hype and confusion that has arisen from speculators, we are going to offer an alternative to those that do not like timeframes measured in years or the exceedingly high-risk involved with hardware. Enter Iota.

PART 2: IOTA

We decided to start developing Iota because it is needed for Jinn’s visions to become a reality. We analyzed the options available anno 2015, (Nxt, Bitcoin, Ethereum etc.) and while we strongly believe that each of these projects have killer applications for their own domain, they are not fit for mass-scale Internet-of-Things micro-transactions, which is a requirement for the market for the Jinn powered devices.

So what does this mean for JINN holders? Due to the nature of how virtually everyone came into possession of JINN tokens, most are used to tokens/coins and the markets/ecosystem that revolves around them. This is an offer from us to JINN holders to get a safe ‘exit’ into the familiar territory where results are a lot more immediate and reliable. We will hold our crowdsale of IOTA tokens in the not too distant future where we will accept Bitcoin and JINN tokens.

THIS ONLY APPLIES FOR HOLDERS PRE-BLOCK 549824

One caveat: those who elect to trade-in their JINN tokens for Iota has to trade in the entirety of their Jinn holdings tied to that account. The reason behind this is that we wish to minimize the amount of holders for logistics reasons.

It’s important to note that even if Jinn were to fail, Iota will not as a consequence. Iota is a completely separate and independent technology that will thrive on its own merits, regardless of what happens to Jinn.

More info about Iota can be found at: www.iotatoken.com and https://bitcointalk.org/index.php?topic=1216479

Now everyone has to make their own well-informed decision based on their own opinions and facts, not hype.

more details will come in the coming days…


#4

esperemos que el canje salga a cuenta :sweat_smile:


#5

Del link de bitcointalk arriba expuesto:

While it was developed as a solution to scalability issues faced in IoT, the underlying protocol is agnostic and can be applied in any other use-cases that utilize micro-transactions.

Iota’s blockchain solves the following problems of its blockchain cousin:

Iota does not seek to replace the blockchain entirely, it also acts as a supplementation to the current blockchain ecosystem by acting as a oracle for smart contract platforms like Ethereum and Rootstock.

No termino de entenderlo bien… ¿Se trata de una nueva moneda POS, o de una capa que funciona por encima de las blockchains de otras monedas?


#7

#8

La IPO va a durar 27 días, a partir del próximo miércoles.

Recordemos que el valor máximo alcanzado de Jinn ha sido de 0,0255 btc (17 de junio de 2015). Por lo tanto, si deciden hacer la IPO con la idea de que todos los holders de Jinn ganen dinero (o simplemente recuperen lo invertido), el precio de salida estaría en el entorno de dichos 0,0255 btc por token (en el caso que se canjease jinn por iota a ratio 1:1). En $, el máximo de Jinn fue al empezar a cotizar, en el entorno de los 7,4$.

Aprovecho para linkar un par de artículos sobre IOTA que creo no se han puesto por aquí:

https://bitscan.com/articles/all-about-iota-ii-the-tangle-and-quantum-resistant-cryptography

Por cierto, ¿alguien sabe cómo generará beneficios IOTA? Por lo que he visto, no tendrán fees…


#13

Si alguien quiere comprar Iota ahora lo puede hacer en el Monetary System de Nxt:

https://nxtportal.org/currencies/10176659922964555108

https://nxtforum.org/alternate-cryptocurrencies/iota/msg204686/#msg204686


#14

¿Estos son los del jinn ese?


#15

Iota es el nuevo proyecto de Come from Beyond, el creador de Jinn, si te refieres a eso.


#16

Sí, a eso me refería :smile: ¡¡No meto ahí ni un chavo!! :stuck_out_tongue_closed_eyes:


#17

¿Y eso? jinn es de lo poco decente que ha habido en el Asset Exchange, y Nxt en el tiempo que estuvo Come from Beyond como dev core tampoco lo hizo nada mal…


#18

Que esté trasvasando inversores de jinn a la iota esta no me inpira nada de confianza. Parezca que esté abandonando un proyecto fallido para comenzar otro proyecto fallido. A mí me huele mal, pero oye, no deja de ser mi opinión :wink:


#19

Bueno, más que fallido es que Jinn va para muy largo, tanto en su desarrollo como en sus posibilidades de éxito una vez llegue al mercado (sus rivales son Intel, AMD…). Sin embargo Iota es 100% software, basado en tecnología blockchain en la que CfB es un dev muy reconocido. Yo creo que si la beta gusta una vez salga, Iota rápidamente va a hacerse un nombre en el “cripto-mundillo”, y eso suele traducirse en subidas fuertes.


#20


#21
SWTOZTEADUONKZOMXZTNMYXDTSCFRPY9DGEGWJFEEKNIVBOEIXUMDIAVOKBSNBQEKMSAIWRINELXJFTYC	54 175 037
IKSAXOFXAIXGGFQKJYJV9JAQZRNSFRQSTALPQBNAAASINFVIZDBBMHCWFUQSZLJEBZEL9KQHSDNEWHNHL	39 948 199
AREJTGEUOHSXTDKVCYXVSACDBVREAZJXDIECFIBTNUVQPRM9JHPZAOXDEZEKPWOHPBUMCYRTALQKFOMHI	34 396 849
RYUELVIFFUPYORXGDANYSEYKZEEDLKFAINQGQJVOHVJZQRDUKKHJUZLLZMIAQACZJJHBVTMVKLCO9Q9BS	32 714 394
STKZQBX9YRHLYNACBGGADWFLBHAQHTKSAZOJHOFBMCZIUFDRIYDAPSREHSI99RYYMTEWOWJXCIWYULOYO	32 603 913
YEFGJOXCWHSLXJLUUGGUXEHYFGFEEZFNCKQNJTCHHCXPYPSOLVDJJXKGXG9FWFMLQSLUMKGDZCKOVNCFO	31 029 650
ZBUWOQPRDYWYMBNZORVSKXWYMCLXNKLHXBODIDDWUEURSMEGEQ9KUHK9XLXJINHCEMOEGMCKNCKJXRLCX	22 559 846
OINJIOTCENNCBPBB9GEXUBVKCNXHE9CVF9EDPKCQXIA9DTILLBENXMWRKMZUSWXQMBUNQDOZDDVLSOJTP	19 284 238
HEOHOTJREDZXJNOYDGYWXGPNJVTOCKEXMK9VTXHZHZWPUVYTULFSVRMFAGDM9PNGCI9FASS9ZQXTVNYXA	18 961 263
WJRENQNBQNKCNSXIEWHHALLEOHVNTGHMFATKNJJIMBYXVLHRWCXXEHP9LKMZFJNTQMMLPEWZYWNMYKEKZ	17 198 425
MYQGBPICKIOXSYZT9YOBRUPWQ9FIUCBMTENU9DWVOSX9KXLD9XFTBCCHEBFVMZKBOQTBSTNLWI9SMKTDN	15 478 582
QZYWVWNZVJXSI9WIYJBWJLXBPBYTUYEPTMLWB9IO9INEIDCYTTMZCYOAELZCOWZXEIHKTBKPFSFABDVRB	15 048 678
CQDBFXQXSJVKKDYRZODDHDUIHPWKCRBPB9T9DFJUWVHCUNRORYZWCCFLIDUGSMDL9DKFCARPTGZEVZXDX	13 543 759
CPFPXLEVMXXQAZNGQRGEEZRRDSBMCYLQCERPS9SCVYD9AUDRRRKDIDOCVWKGMPJUVWTJVARAOBLVQHDXP	12 898 818
HJZTAGXVXQXUXOAALAIAGFG9LILS9NKXM9BFFQCFAZCLEQPFJNKHZ9HCVYIHRNYTFNDAGQOSAIUEMQAUL	12 898 818
UBWLNHURWLRYZGFQRZJPIVOYLBIDEM9LXCDNSBXLKQXHAFSTDKKXIKMLRVQGRDOYQWPSMRNFSYMYRYWP9	12 106 468
9BEGGWPPO9REJOAKRHITKTEPUIQMOQHUTOSYEZFTJQSYTY9OLAGEQBHPAPKBZXYPV99LMMSERXZYYAUJJ	11 178 976
DKRGKXQBYMPGOUVAWXJAKTCLCTXMGFOF9YDPXPCNGJBOPF9HPWVDGMKFSVOEQJZFHSCSZKBSMGUBG9XYD	10 835 007
SYKFIAJFRLTRBXAGEYKYMVLOMCWKUNOJCKGXYKFPIXSYIUCQSRDOAXCKUMZXRYFZUARZOXCIEUJLWTWDP	10 768 644
WAWXIDBDXGLHGIYBPFARERMXHGTWEZ99VFFGFKZSHXPXCUOSEMABWQBNMZREUNLZXJPMMBBHMNIEIAIJF	10 585 802
QLLLHCLUOBWXRZMJOOGGVCHDMCK9LLQJZOIPLRJ9RVYR9KSAMGQJWEGQTLCGUZSHDZMPSPFBLMJQXKPKZ	10 362 051
QOUXITBOIQWZFKBPMCRFVIKRLGFBSW9ZHMFFUWGAJQAHZFFQYHDBROVAQKWYWUCLRVFHCPDMUYWSSNVWS	9 240 246
SXGXB9MXEYURBCFZTBPTINQNWKPONUIZPOLRCQOUFVUA9SZNWGAPPSUFCREBFDJOT9IHGDBKYXQZHWNXB	8 842 233
BLJVLNJTJINGEVDUSRWHUDAJFTVSTLXFXBNLAIYUDFJ9IIGXBFLRYL9LDFPCBEERMMBFBWLMINCTVBPCL	8 599 212
CCQQIPOMUTABUFTLBRNNQ9ZSE9JAZUNISYKHBSANMVMUCSPSWGQTTUYLPHAPEFNAXPPCHGIQAHPBLVXSI	8 599 212
JSILOBGKMRGJMUUEMFXFOSDSISGMVEO9VCAQBVRNJZNPRJKGHHAXBXPNSWHTZYJEKDZ9TMCRHGWLAHCBD	8 599 212
KEXMIMPTLBF9QSLBSQWSZIOEYQVLPEAXGWHKEIIVYXTBIKOWTHSQYCN9JTSRUPAHSPHNNRVYAWPHYVXTX	8 599 212
PIQRGVDVTVNYYIHT9WTKYBDDRXQMJZPATPRSXWXAPLVJOEKBFTDNEBGH9UTUJMYEMQAZWJY9SFBUFRDRO	8 599 212
WHETNNNGMKYRBISDAUTOSD9VED9RAYYXDAGSASEGZROASWAQVGJZXGPHLLGFGNM9D9QSQEOPYFMLDPEIP	8 599 212
YZAVDTGFYMDYDJOINLOFDCL9TPYJJNYKUC9JIKVGNWKBEOCPSZ9PRPMQY9OVBPXCRPMZYGWKAVOELQGUJ	8 599 212
GFRUSSU9TZUKMWCHVKYVXCFYSS9FWVQK9YCLAYTJOFKJFWXVGH9UAYXWUGPYBLPHIGNWMFERLUXYAWHUR	8 521 733
ICWEKUXBBHRGVOSFDRFLMXGLCKKRMCWJOIWXFO9EFHYAFHNPKXWFYKHYYWQH9J9JETZJGWTAFUJIRPNPD	7 739 291
IN9UFRC9ZMYQ99COSIPAZQHTQJGV9SYNTUHDHLIYBLYAJJTIYLCIBBUUYHAXGYBGDSUFLLRDZUGDAYUUK	7 718 798
OGZWGJKIAADFPXPQCQ9YSEPRHCPFOMCIEXWZODIKTWIGYJSZYYSDDIRNXZZIJMKGYGTDXLKXYF9TCYVOM	7 708 166
WO9IVDIYBWESKJDOZGPVLVHPIPTQTZYVJLAWN9SEFNFCYMEMIWQSIJINCWDEQJSZH9DJOMTWJBKPDKYQG	7 596 282
OHDMBMNRYDTECKXKJGOMZZSMUYGYGNGZEKBFWPLQQPH9CPPUFNWTUDXAIWRCBSBMPCSMRAZIGGXNSVHV9	7 477 576
OGEWWYNTGOUNASMVOSCZWPDNHNCVWXVVJQKEYMSLYTTIRWTHIRZUQTTHHOHUEPNAP9ESCIXPFYBOXZWPR	7 266 334
AMLODDGGBXBXE9TUEUVFJEOLHWFGEXANUKNBPJIUZVHGUUDEWJYZIIKQUQDNJBEXRCZXTRRSJQK9HRDF9	6 885 389
9OACSTXZYKIVYPQ9LNCKAPDXFBJUPQWVOG9NNJYSG99LWQUTCABEYFPI9YXYKQFTRZKATAU9GGNGLFFMK	6 497 130
MDVHCEM9DFRCLTRGMAWHXMXMTVIRHRFQKBX9TPKCXDTSGLNXIPLRPFIDZWOWGJXBDMPLDABBTSXAGR9PX	6 318 929
FMJXMKGFOIZVFKVZIXRHVISWPUXBJACTDYGKJECVFIIXNVV9HDRQXZVAEGTXAXSZKGT9MMIUZWGHNMPIM	6 019 449
LMJRAW9YZWVCHQLTZBKWOZAOIJSPFEEPUHIPZLWR9IGSNVIWKKH9KIDWKSDBBGWFAVZIDVXVCMHPWKDIQ	5 973 088
QQDAJKRDEOGCYZOBMGCQHAOM9ASDTQDFVYQTQKTVPUYZGNYECCDACDBPWHQCXMNJTVRGLIVXTOEYNBUNO	5 959 254
VJIPHZILPJGRBJMKYUYFOPBASIWWFRXVISDHVEVGFPLYMXCFYMNLVVXWVTKD9YIYRHPRKRONVUPGWYJ9P	5 693 796
DQZUANJUWYRVYNHFWYJGMSKLCXDUC9ASUETQQRXVBNXGTGQSXURO9SAHPIYAYSHYFGUQMFUACKALHGOTT	5 234 303
IVNFIUNCQCJKOQULHMKTIWFQXJPRZYYIOLUENNUUSXYXWFELCAVHDDQGRZCGWSQMTXBKRHYEWL9KCZ9NI	5 234 303
RNRLQAEVTNLBJMQOGLZMIWDHWHSSBZBJQHBPTFJRIAYCSLIGRJAGMSLHBMRFRJJIERBPPEGRARVRUKDEY	5 097 837
XTVLTHYAARXWVRDQZUADJUJCVUJY9JRERUNWHCUBHPSRUAGAYOAOAKYMTNVRXKRIQMSGQFBCEORFACPNL	4 991 282
DBXV99XX9CAOPFQEOUEGICVAZQTJUJJZQAYKBIHAUANZEVPSNEVVY9BQUM9DMMUNS9XXSJNHFCXTGWHBJ	4 969 764
LCCWMUKHBVNRHGPWCANUUNRCZLVBXYQXPFDVKFJJYACBSYPEZVVZRUC9XMDFNSGOLFGZJRFNUAOXIQYKY	4 944 547
YHGKACCKM9LKTWCLCHIVOE9RMLOTGZLMSBFHJZOUINZXRYQCARRPECCJJWMLLKW9JT9ASJWOCVQTVOTGI	4 385 512
DDXEKZRPRSX9GXGCWAGFFVNQKKZQTXGNPQLSIPSTM9ZNPFBKG9WIGVRYPNQYBFZZVXIBCNGCGUVAHRRGO	4 384 738
FOXWKPYRKOQENHRXVOEEBIVOOYAMADLT9IXGQ9RGSGIVNB9YENZLDJOLLJU9EBEYUD9FOAYAJDRLVCOIP	4 381 299
RZQURJNVOIRRRPTMNHDTFHTXBESVUIPAT9CHVJVHGZZJXXUMNURUEOKIWKGCDSEMOM9VL99RZS9PAAKGH	4 334 003
ZWU9FMBYKTVGFWFGRBYDZJVFDUFMAVMJDPULVQYOLAHNCMMN9EOMWMEXSKYGLSEHVGYNTZTBDOHPTVTKJ	4 334 003
9ZJLHEVFEDBPGNBOHYRCISNPKGKKJBNNRYYVWQJRFZML9IREFEOJHGMPATUZIDWONECCLLODGOBJWH99M	4 299 606
ETKVGTBYHDKHFEASYCEIVFOEHAWCXCLOCNENCIEM9JSIGSTFTJDQUBA9OH9PMOBOWI9NGPGQXTPE9WGIE	4 299 606
GLKHXLXSELLPEGCIXMAIJEMTRLODIUNHGMUMPQLSIIVMTYSKJHTYGXSAZIMDUPANMZTYPILPMIWJVFQKZ	4 299 606
HACLZDXPTQJVZWYCQZVHSZYOPKWWZYFEGDAKKZALRLMAUQWCGSBIXLRBFBUZIVIAR9KRODYZWUOMKFAMT	4 299 606
WPRMUCRJWXBKHCZFOLJEU9ISKMMFJYUUPQRCDQSPVUJUVSIXJPMHT9GHEALOI9SFLJTIVJNHHRFLRCKOV	4 299 606
JUKSIOMBVNNSABXALZUYTRMBZACLQNBTSNGA9EJINBAHISXNPQDCZLXNZABAIMBSHFRBYVLRPSJGPFRWK	4 291 007
KYUEFGJIKSRDWRHWUBNHJVXAORJFLFZONQBCTVXVB9GKKYGLGRGJIXLKMQUUFFPUNLEMMDNNDHHQMHEBH	4 238 917
EQLQZMEGDLNIHNES9VDWSQNQWMDGGQLYKQZVZMWWVVCVRJSFDBHTXMIQXXHLHBVCQUKQNLGYQGAAQAXKM	3 738 788
DQIGDCGBKZNKGWOZIIMVRKABXASFKICDVTOKBPUC9L9LJWMGRIAMDQBNLAVATXJKZMEOWUJGJPYFVPXT9	3 678 743
ZVKEQSENNGVEUFYUCWQPIGMFEMBUYIX9MSMTFHGTXIEPRFJNJKOFAGISUCVNPGXEDLXVZSYBDQVJCCZWX	3 657 245
CJQODRBEXJDCDWNQIPY9VWPAJJGAHKAZLYJIMIMNSWHO9YOBOXJTKLRICXYPVRZOJEMFMMZBRPCEUSZUK	3 439 685
CP99DVAAVCF9VXDJROEMLWM9NJAY9SKEBNFAFGNBYAHOQYFAYQU9FFUTYLXLVHZMNDPKEQQL9WASGKADI	3 439 685
EJOGVPABYIZPCLHCQOIJIBRYJOTZYOQYSM9YTBYBYUXTUTOUXICACLGBLUREMMW9VXDKCBK9BPLKWDFOU	3 439 685
MHWOYYKEYOVQTJPEBIHX99HNPIAALBCNKOQBVLMGEJ9DEWVRPGGCZAKEDVIOXJRYEXDEZNWNETOTXFZST	3 431 086
HILZDSLAXCFF9FVPLSTQRAJMVDQYULNOLIMMKWPXTEJWXNEIJDDSNSTEN9TK99VZPQBKXPWUREF9CCTKE	3 304 677
WOEXXABEJMQMIBBANVDICBDKUWEMIQCSYSWFCOQDBMGFV9TYMBQGJPMFOUDMMVDOJTZ9IXVKHGRLYKL9I	3 142 451
KQCBZSTJKROJZGMW9U9OKOGGLAJQ9IURYWYSLWL9HCPOZPMAGFFRSL9DARIKVWKOTV9QUOEVRGHCOUTYB	3 138 860
DURFVZSTNFU99BPKE9TLBKLRMYBFIYRCAHVQUJXV9W9IVCDQRYWWRABACDYYIPFDXBUCKBWKJBWFESJUN	3 009 724
CEDWNU9PMEHZYMRVJMQIZ9ZEXDQHCDCXPFOH9QXJMZAAB9DOECKGDASLMAHUTOULAMPSNQQHLUCJMOZLK	2 903 832
XMIGLLZZYNAJTQXLJTGKEXGQJLZHMITMPLHQTNJCYTMUJAYDTPDCCKLTXRFNVLCFAFZIN9FCTZHSNWSFV	2 837 740
TYURIDIJMEPJDMQJWCOWQHOYRLWUCVBNHHKMDULSHBQGGNTJEBSZQKPL9M9XNFXRUKISHPYX9CRDWYRBV	2 708 752
MQUVXYFCDJCMFZHWFWFTDIBZWFTXZBJYSBHUJKJDAUMHUOGQQNCQHSXGSUMRABURXASDMPLPUCTBKBOYS	2 701 522
9ESVVEMS9DRFSOQDYHHVERWSAXVDBPNBYWPPYMDNSXEMSYZQCEBCRNKFJVHDQS9BDQSCNVQEITYLVJYZO	2 617 152
DITBSJKNONVDHSVFXPSGBEDXUZGRULFFCMMHDX9EPWSI9ATWFTFTLAMLIIMOPDNJLDSYVEIEUBGIEMAPG	2 579 764
DIZTZYHHHKSYRRAHHCMPXPEKCCZRGFGJBECMVAIH9VQKH9RKAYDEJIWEHPVLRLXQBYZVFPLRVW9NPRDPI	2 579 764
NEAQIAKSVARYDCWDJCCEPXSWHUYFEQQWHIGRLLPXVNNILWFFAUNRHSBFLYLVQQXBHNDMSMZFAIGVGTYRZ	2 579 764
ZJZSLZZMBEURUPHECXLNCXOCIPALXDNNLRGWIPAKUJB9GRTIEFIQCJZZRZONUTSXE9OVETC9DUXIHIRUS	2 579 764
HGFFSHKRQGO9CNVY9NCRWMVF9LHROZO9HKRXXTSUIVJBIWHPPZIHQQDKALJOSLIUTVRM9ZWCZYXAVCPP9	2 515 606
IGM9PGJVO9TVHPGXKYVNSVWVMVNIRKDP9EJTDJH9DWKVLZRBAVETJQNWHXZRJNQZZGQJOOTSHCXKUQVQM	2 493 772
KXWLCNGCSTLS9XFWCFJLHOWOHW9J9MFQRIHIRDHFKKQPJFBFKEEOXYGN9NAQGRE9CJ9GHFHQDTDUXOKIF	2 467 114
OCMBEAETZNCSRP9XWOKZLAKEZIYGYEFDDIGOBJPSRJQXBAJULTJZRHPUBPOEVXNDBHGGO9HUTUCCFYSZI	2 411 518
IMCPBWIWFYVEMSSNUVOHCXFDOEZGTFPGTAKV9QKKBLHEWZUVJEMHTCMUBKKCJPXQKHYEOHFKEXAUANUNN	2 337 508
ATWJ9FWGRAO9YCXWZFGVDXOIYTY9S9CPCSOJGPYKFBTKBRPLAJF9ZNBMA9MKHROTTKWCXYUHB9YZW9GTZ	2 321 787
LGCTUDPTAJ9MWPP9TWL9CYLNOSMPHCCOEWGFAEBSIUDNIRCDUBVCACMLGFQCYRADHKVSCXTFXECAXOTYV	2 311 468
PBXMHFESAHNWECGGKFQAVAZCFFIXXKIKPGZWDIUDPRZSKVFHDNFRVUDXAMVGVCPOMXFBCMRWSMJNJBAYC	2 167 001
HVAIUENXVAEREUVLJHWHFLPBPUWSVUTLO9V9IOTW9CCVCDFYQDBYIFIAAITBTCHOXSBAR9SADSWRRVASD	2 112 826
W9COIRGLRZNN9XHG99MDP9LMF9KBUO9MFHALE99CLIVFTQOMGTNJFIVFG9FQG9Y9PQCXLPJ9LNCP9PXCI	2 106 807
VISQCQOFKZIAAUMNKJAHAYPL9EPTBSSVQECSWXGXWNESNYQOXCHLTF9ISSACIMZWDPASTMARAMJOWRJPA	1 959 125
FIHCQEDZLYSGOJXCMIP9TZEEANQAEKMLJLXJIRACWCO9DVYYZTYBQLWXIZIXNUZJOXSGZGFGHZZJOCIQ9	1 869 394
9UGGUPLU9CDPSXKVTPVDHPDVOSBRQGFKXCKRUQUVFDTROCVIQNWO9EAVFC9EVMBPOBUWGKPZOIU9L9MV9	1 787 776
QDYDWIZOVPOHHEQLEUXV9MPVGRSRVNTTHMYCXTIX9ZKZENBHDLFJWCIREJZ9ZETGHGLDLO9BSKPXZSUXX	1 760 689
ANVSJHLHNYXCEJINSGVEVBXNADCZR9EGNRNVKQTBGT9RKPHWHEXFEKHMD9YIQQGV9BXST9KFANEKEKFUT	1 719 842
CBVGHXPFDXUEAEHWPJNAOLVEIHMCJJ9ZYNFRDEJGWEB9GHDGEXNFLZGYDGVCQEDFYIXGWRBECICWPLXYM	1 719 842
DXVTZJBZVNUHGVGNDRMYKNNUWKGYLKREQBJZXNMHLTTWW9EOSIRBFMVEKBJQ9VAUICCIUDRDNOQPOUYYU	1 719 842
MZFHSDYNNPYZMAIF9WQOTNRCNRH9OSJYNXNCTBVGGRVRUKXTGACLVRTDUY9QSNFQYHITQUTTDMNHYZKOQ	1 719 842
QGZCBBYF9CCDCPNVECZAGPLRYK9GPCNCFZEFOLWBTYYHVYWBBBMQOTLYNONKWMCTAWQTHMSDQEW9RTVVO	1 719 842
ZT9PKWRLHKUVIRXUC9LCFEDTHSKLSFJFOKSWMRTGJCI9BXLMKZMMVNKJMIHVQBALZARDTKQ9YXAGIDWJD	1 719 584
MIQXUTRPSBGBS9AXCFJVUNVKRZFSWBPIUGCIMTHBECNXA9VBUZUIWTUMABSRKMHWKKN9NKMYFFJBQSPVQ	1 718 983
PDVCTJGTHOAYYQE9FAK9XOSZBCRYXES9Q9AGZDBSSKWTWXV9MQELWMCUNUVULEPIORHCLEFLKCXF9QQED	1 702 644
P9QXZWBNAHFBBJMPQXCSQSBERHVALKTXGXPVUXZGBREKRA9HMSYKVKCFOYBGUDRYYBHNRUTYLEFGSHE9Z	1 633 850
PVVZMMNLKICZY9QHKJRBPXIBZMZSSYDESUODDMKPHQACWVSACQNDKDICFIXJZBB9JRLJDS9TMSAXBEMPF	1 625 251
EZRZCZNMD9FRUPVU9T9SKGDEPUYRIRBDRGRRQLHWMWWHDTRYDLRICSAPENJNBE9HRAWMRZZOXINXYJUNP	1 607 967
OPHFGXSYIORBVIYVKW9KMIJDOEUDHMOXNKL9LZIPMZZSSLMZAVOQ9TPMXX9LXNJVFQAGEDXAJAUHVJSLT	1 607 679
9NZZOVGVSDHDMQBHHDXIIFL9FBSNWLTKIFQIDUWUTDUFYEHUDSVTSDTEJZMGOGIWTMXCHVNGQOGUHKTWM	1 602 071
HCZOZTQTBWUCYWOMFXM9YHQHGRBPCPBTPNAI9GCOVYATQEPTXAOHSXAYLXHK9FIVSWGOCQVNRLCMRBL9C	1 577 993
GQGCHNWJTJGFZMSDECITBSVWZDROYBCYFOJZZWTOPUMZAGUUMRTAEI9IMTDDGPQ9KDFTFLULDRFXVAZAZ	1 547 858
NBYZJVUNJNH9VSNDYRFMRCHDSDJAWYMSID9ILMRKXZHXNFLRGMH9QA9HRAAMS9TKHOLXBCDNXCQSQUEDT	1 461 866
NIRQZVPWYLTEEOXBMIWJSQJMVMMDXN9RAAPQDAFX9IZFQGUVLDCANVZUGT9KFTVEFSXWGVZRMBFCRAXMB	1 461 866
PJCRWEKVAJAORBCRLGAYAX9IOQRXMLVFCAN9TJYCYHPTGDDTNMZSNM9GYKHJUYPKT9HDCOCKTULEPBDDI	1 461 865
EVJDPNRERUGMIPKTKZLLVRH9ECZSGMIQXCBVIWSJDVACWXDTPOCOABYWRQRHEAINNOEPLQKJKXTJIJWAU	1 455 992
CQQJKYCMEXMZESGBRRMOTVD9JETF9AANTGEJMWTFYHKNMPTWNCWR9NOOZIBFVPEZIHCKJMBHWCEWHCGRZ	1 388 699
VGIIF9AIYPWADAJDAVPINQJSZXNHEHJUPLDYVQPXIGQBBAYGCKSXLMZKQMOYQLLJDDVPFDQDCFIJXKRSR	1 365 211
MSSWDDR9VMMLXVHWTBO9A9KBFYXUIKKCRFFGJABZAYHZAAXCAXUSKIVBXCDBTGDJXIOVRZSATEQXFVMKH	1 300 201
ELZRWFKXQRFRVDPFMNRXACGRRJPRUKEIXL9JVBOESZENFATENQDBCOINAXWSFGHXJBSAUAVDWVHIGFSBE	1 289 882
SGCDPMFDEEPLPPUQUQYDEFBFKRTMURWZLRRM9UTDRODHTB9RJKPQFGBGVZFUZ9ZMKGGSLDB9DHUINJQSJ	1 289 882
PTNMENNQEKSUKANXDRTHMOM9FCBCHVRFOYECMHWUXMIO9HCUWAURFTBKZGQHKPZLXUVWKMITJBAYBLICC	1 289 765
AYDACULMJFQFPKSUTLPWQLENXEESTCCY9KFAXQSOMPIKDKKEJNWJZZGMHYKIBZQDNTUUOPNSI9KNQMNAN	1 289 366
YGUTVKD9WMJEXKWHZXBAKCEGLQC9NRJ9LGXMEMKRUMPCWLWOBXUMMRHLTEJGESCJWBEM9INUVTLNKB99O	1 255 859
QCZM9EVWPKL9GULLDJHMGTABNVHUBBKZFGYQIWDWTURXUUASEGINBM9TURIVYTRIWIYUOZQSSJFFRXRUW	1 206 563
CNGWLEMNKJYSODQMIPXOWTCXSGVWCGNNJNAILWCQGTIDYVZKXB9JW9XQDTWMJXTWCZOMCCJKMTXHIPVNN	1 203 890
MKEXAVJFVXQLP9DSXLPGKPJVFIMJWNNRAYCAMFILAXDAQEHLYVJATNVSMYCAHWAYLLZUJMNH9XBOGTRGI	1 141 617
NSQLUDBIGGRHLNLOMAYHPTRQCINOHTDHICSDDKJCCD99QSNPFAPMMRKYERMUDIFFC9YOBMJZNABTDWZML	1 121 636
WVNZKZGHRWBBLQNXJTWFNDTMJUNAAGIMLQXAVRJAMOYEZRVLW9DXJWGFVKTZZIQEVHSHOXNB9CTFYEISY	1 117 898
QTKVSNWCFGOUYELQBAHWEHKZJEBTYSNALWIYZYWVWYNVIGHAQWPCPCYQJ9CFZUEYGCVJMDUBUHIANGNVN	1 109 298
QKUBVYTWOI9BEARXEEAVYLVUVSEIQEAFCP9NZKTDOTKBAUCDMRRGYFHJKQKPZJNDDRMWOOVOZBDCWSTWA	1 091 154
DVJFOYOSPSJULZDWAQALZRBTBGVCNLFAPYYQNEIGFYCPHHOS9ETOJRPKPSYOFGZAZIAICC9BLBGDIPBWI	1 083 501
XFGFNQWBZB9XXSRFYLXKHZZNYLZZKBCZPCSHVXAFWFVMSLJPLIPPTBCGQOZWUKDPWVPYGJFIQUMV9ZURF	1 083 501
WRUPQZNGUVSLKNATPU9BDFFMGXNDZIX9VSKOOXP9VWYBFODITNY9FNWEHXGYJMMRQWJ9YHTJIKUUJLKFL	1 050 996
RMKTWLZVVJYBWLONMYUYYBBLKIOTDTEOABZKWRMETPSAZSEDJXCDMKTAIOGMCEZJGINP9EPPFQLNUMYVO	1 024 684
KBHUVCPUO9DNFZC9MUIF9NEUVLSUAQMPCJYOQAOZRGBVXATGKHVAQQDQLLEYVIHXKRFYFDDJQCSRXTMWV	1 014 707
UBHS9ASPCP9DNXEKHCEYIMRRJVKLVARFUAJBFTKKKSRNSASAZPZBDDEBUXXAARNSBJOGFCIAXFPA9FFXV	975 151
XNYEQGEYBYHWEJHPDOQAWIAFNJ9QVQROFVWWWBQURNFQL9SUU9XPJRADFGWXJXOAUCVEOLAI9LJEGULOI	962 336
XQRRU9JBXRZOBYDSXXPN9ASSARJNKNESJMHSAAYKDNUJEKXUEZVUXIBQWOXGNUSREBCGDGFYLTVRNVMXF	955 372
QNHQB9NBKLOFVVUISYJHXTCWDHLTHOGSFMYHVTMVPBYWLHNWSWWQAOLPKYRYEFYDAEDLYZXADJGHABQYB	945 913
UNGCRSLEU9VLVED9VP9APWXNPOHOZSNRRLJMQYDVEOCRUKZNJOGVENBDKQLIXHELRDTMGODXHFSVLT9UK	932 454
GUTUQXSJXKYORMJMEDFVRMGAZJBGHTXHBADKQLAFIFEUBMSXGPITRQHISLZOMYCUHTYQJCIBFSJJJFOOF	920 116
HZYBMSPKHLNLLSGGAXWFFZXPZU9VSQDPUWLSJMAMQSQCGCDOJHUWHZDKCGEMLCDKNQETSF9SLHXKSRIKA	915 558
UYOAJJO9HBQGVWFKPBM9VWDOMHQGIWSND9XXKMDDPQJYS9PAHATIMTHFJADHGDDMONWYKBWBCVQSOTSRW	911 602
RJPMGOSQK9VNGTYKAQLHDHCJHVJGUQDHWOBIPHCAEYLHQEMDIRCMXSHBEUHNMJMY9BEBTBD9DJCUZLMLM	891 327
DLINILBVKXGCTVEDGIFENUMKPOWFDSIQBBNRXOLMPUCAHLJDDIT9FIHBTGOUUQGMNWOAZZGRJKFQBPKKK	876 937
HBDGATVTSXFDAJLNTNRKEEOTLENQDOUIDM9YEQCRDVYZXNCLXOCDBSISNXNWGIOOXKSDUVEIPJANVYZKI	859 921
JVYIHLWOVZKTAOEZCB9AIGDSACIKCSDRLYRHKKARLBORNFZKVNIW9APPJNSDFNGCBAYZUZSBCLGBODGRH	859 921
KR9NRTESO9VMINFW9MIIHKHZJPBHLDCRTOSXPULZYTJJIJUXZ9FBDPGXINHPDJSDAGAUOJTNDCVNBLYWB	859 921
KYDUCSTXVHHTSPDOR9JMEZNZQWJDKMNCFKIGQNJWODSIJIJMXLNCKZPQYAUTOHGUTHFRZVIFULAXDRADH	859 921
LRDDFGQBQAXLMWMRFXNRVKEHKHH9ORDNSHIKOZCXICPQVNVYFRGYURYTEKHOIIHRJTIJVDVTPBPPZKCDV	859 921
RJ9TQ99XBVBOMHHRGDKCWICSGB9EFOVBBSZRDKNQOJBKECEJQ9BEWRNNOXRHNTDLLRPKZNPKBRNCUCERZ	859 921
RJHBIIVQUJFGINEUHQUITOMEVPQEE9YQWNCTRDOPHNXVMVBORTVRKYRKKDNKQVEFBKSICPLUCLVFOOGZA	859 921
SQFUWPKJXPLMIGMRIALADGJSSVB9JZXDBBDQBYGYURTRDQAWFWTGN99IWKAZEDV9NOATAHPZH9QBHS9LF	859 921
VGTGQVNAHGV99KJXNNXQXAIIQMGIYGMVERTOWJPEYHECHSJSBCSVTYDGUGLYSUSDCATYYZRE9SFAZSIDI	859 921
WVAJCEMLNXQXJNLWXPBD9ZOJKF9X9RUHVLQOXNGHOLDPAPYWMOUJFLNPLBZEAILHQWDMUUDUPZFFHHCAC	859 921
XSTZXIYS9FJEIBXJRI9EDGMJPBFPCGUOZFIBZOUWLUUQFJCDZFPJWHRDHVAILMNIECTHKFNJFDJU9QCTL	859 921
OOBYRBXDACYWMQJSJQZSREMUPRZYTQVIR9UOUJRUR9ZEFOZOFTMARRLTKZWS9JHQGCUKPTQCXHLEYPDEW	859 061
GHHYNFCQBG9PFEQJNODWCXCHSNTXFLVOK9FETQN9EPKHTPPCGZMHPGMSZGGDPDYMKRBRBRLCJQTCSMCMM	858 631
RUWIMKOATAYO9GJHICBGHDBYC9TKNAHCIJJOSCMGRBRCAAMTRMXCMFHXNORKBPYJPWZOKGCCDJCTNNKRH	827 854
JLT9OPBXXMVBCZDXGXZZFSYKJXKEFTLEGZYRDBETFQKZDJGPHBNDYOBIFKCVNEXDIAXMANHTVSUZEIPYH	810 270
YMZOYNOZTPFVQU9TBBWEBSCSKEXRNRNMGEPULCSRPMWUMRJXUGM9NQZIWNH99SK9QEIAZOERMADOMEMEQ	803 839
MCIC9KHJLURWPEBBOAY9FINQSMVUJBAAODLOSLAAWNHBVPXPPIMKVJBIAHAJLCW9PDVPFDUOKONDSDIWL	774 677
CGTOLP9RCUVLNXGROTFVAKDSKJNZSKRCTMJXMJKRCANYGTNJOSVCYWYXEWMAZKMMPKYTKTUAVPAPOURNP	765 330
UCQYSEPHFQQGEYBTDETLHEHNPQBEMGZMMALUXZVKGJSGPYXWJABFODOLKFBSSCGLQFDMWMVQDMLEHLRFG	747 758
ZVPZFAGMKWJKAV9XDSUSZSHRXWFZPO9UCQMMKIWKHOJTKWEFEAXOGRGWCLIQWTHPEBVZFGXEWPJZSPNIG	747 010
ULBODYUXMQESAJWRKEULIAIVTUJXVGATJTVXCQIHBY9FQRQPWOQPTJPHSELZOBOMTOBBBYFYRTQUWPIGW	745 383
CSYCDHQWIGJTUN9F9GKNUOORTWJXKYOOD9CRNNLLWCNFGXICQQUDGLZQAGALVQHINMIFBSRYGEXPRTWHA	732 802
JJKPPPEIQHYUAVO9DLVIMBJHFQDBOTQRVB9DRHGZODSHHBEYDYCGRVKPHIVYSGXSFVVDFS99BMIFNABOR	705 565
QRAJ9KGTY9TYVSG9DBIZVWZPTQSURPZRPCLNYDUBBTAXBXLDQTCXMKKHDNVHJSA9ZDZBDNGYNDUFJBPVF	687 937
9DHZBCWMJOLRLOVOWCIT9HBPZURHZPZJQCDASKTVEZLSFVOMZDPYMJGLEBBWNCVVQWRRNRWTBOW9FYTIP	665 579
CHJZSTQGPCFFKFSKHTADTT9QBYEVZMEBPXSJNUJBQVSALTIBPCEXALJZW9NM9IEV9VWZTHMNE99ZIBX9A	608 974
DIGRYENOJBXNUEJAATCDFGGLNYCYEKDCRCHMEZETFCR99ESPYEDBRDJ9ZQSNFOYQQLRSUCKT9DFJSLNII	595 925
HBKJPTYXMAHTTBOQXQTJLOAQGWMLXOXL9CEYGWWCSVYYWZOVSMMOFHOAFLSQTYHZTHZPGAPIHEEMFRLBZ	586 803
OHXNSAM9KSKNRHBGGHFNOYLCWVABCFRSZEKHEUMQZOIICIDOINDGJKPEAKTTGUZLAX9DQHAGEGJXZ9DEG	576 765
HAJDHFXQCATJXMGAGSPPTDCLIKCSNWPQPMLZSTDS9PSRNY9ZTVEAZWSWCUGKXFEZRGBX9YXAFBJ9NSGDM	515 953
PEGDEIKENFQKMIN9AWPEGLWWSPLYJRM9FZR9XLMDTCAQZFRHZNGEFJDGQSXWMQHBNPXOMMDBSBNIU9YTT	515 953
YLOV9J9JUPXGNYFQB9ANPTX9XPDOIAGAGHENSS9KSCMDR9PPQFRZCCSJZFVJSZGPZE9VEYBOJWXZCB9YE	515 953
XPMJYUTEMWCXCWUXNXNMABRSADLEGORJYYXFQCW9SNLBCWPDMUKQHAVFSLSFAR9OBIWOLRIZAVQP9JIWP	509 245
ZZYWMTQQSGTSHXWRBEVERNQMLAISSWMITXUIFQCOSDWKSVFRUOGOHNCITYNQAP9HZFWVEP9LEZTIERZJZ	494 866
KWCIZRDENKLBADKSUNMPMURIWZDNCWUTGYRBWEBHXOPHMYWW9OPRTZJVGIEYXBN9FXVLZRLDPQLGNILAE	487 001
VTNJHSHLEUBNKUBZCSJKYBDOOA9M9TNSYVRNXNIUXDPUSEWBMWBJPYOZOSB9HVODNNVIAUNKYPAJRWGWY	485 519
XVCHYOPIEHUYZOLBVBDDRFFAEBD9SQGPNCJNPVUEGDQMRQEZSLECI9ECUEQUMQRPXLXNDQUDZNAXPGJNM	482 304
WZOHBLQJGAUUXBKSQZAXKNRNYBEBCCIYDHCESKJGYHFDSQV9IOSIMKVWFXEIWAS9RNMEFDSVKNZEPULLV	461 778
OWKISLOCTXYNTGWXQCYBGVKO9ECMMVZVJNDQNHNNCWWTFKTBYOYDLWXLFTV9WHWJESGWSRXQVVNAGZBCC	456 132
GKGPWDNVI9WQST9XXRVAL9THJDJ9AZLYKND9V9FTKWDWAJNDZBFVJTBBJISEIEW9YMIZLNZDWVEVAHKXR	443 671
RLAEHTFIUQ9OLAFXUGVVYH9PXCFIIKLQUPRXOTEY9SKKXWESJYZHMOGMQSWCFLHGDLJVKAEJKOHO9HNIQ	441 899
KPELHSFMITDFRDFYEYUNKRESPPCUSWEBWEBGWTFEJOXVISHCDVGJUVULUSOVUAUCQPNNO99BOPMDPAHSO	438 700
CDXARPKWLLJMUNLENWBWFROINPXHLZBCUUPKPRCKCGBSORAPHSHOXNNJDMG9FMYLUWCOK9NYZNHG9QGQI	429 961
HVSWQDKZQZFVOOVCFWLAKZBOEZRJIWYDSZWLVBLLTJPOXHIBIWZSPVKNUOWLGTFSWUTCTSL9BXGSN9VMQ	429 961
KPELSGNH9G9OKHVJBSGHTYGHERXNHXRRXFMAMBAUMTECROQ9KJ9MJLCJVYTKVXASSJARAZFWBPNCSOKGA	429 961
LVHLAHCXFHQ9GLOPFUNGENZMTDA9UJUXZJOKGDYXDKGYSGXTASCW9YTAPHSWAFRUGQWGXBPKTEIZYCTUZ	429 961
XASGRGDQAHUQQDLUGGH9RIEROMT9OC9HJYYVWTVTOLDZBKDVITWJWGCGMPTGLVZBUTZLCZCCGRGVLSXC9	429 961
Z9QTNNIZWQ9UXQIULQAVLRVJLEZPJJUTHCAJTZIU9TAEEKPXIPQMMFM9GOTBOZHZMNEXWGPOIFKSSFPKQ	429 961
NIUHVLMPGVNWINEZN9JFGDPFLFQSWXBKMOEWVYLXAVQCEDVHJDVHXNXCUMYCLGINDHLACENGXGWHBJDWI	429 875
UHANCMXWMEALHUOCPFKHAHMLEZVHABIPPXSVPFYPTBNGKYRWLLZEOJSIKFZCFGICBDMLBGSWCXYYODJDI	417 996
LJSGSFXLPKEKHXEIUMBYYSWFVAXPFPUIIHABWO9JWIJGMQTJEKXEDFKVWFVKFSQFSYIZJLLWGXWCN9W9B	411 267
BNWAHQRDNBLA9SCGUL9XUIKPWDIVQLOZKUPEWQCIPKZMEKXRNTZIK99IRQMTRPBRVACNJXQNDRKBWTAKW	409 958
ELKRS9NHMMFPIVZOIHLPHRFDVRPCBFTUPWEBRLRAULUKTZZDLFQZSXQYHSI9ZSKIZESDZYAJPHJIYYLTJ	404 163
LZPKLSQEQPYRHHDDYFJKLQ9JHODTBEGKACVVULIXYQTNECKTG9UKQRGOXOYUNUUPRUWMTIUUOAUREQIJE	401 920
OGVGRG9WZOUSGNDESFUYCBULDOWRCMTPTXTTTZRUTZMUFPRQ9VBPO9XXIJKHXTMOKRMVRJQUDYRREUSOQ	401 839
ARNXPYNDOIOYNS9RPALNKHDYSCDKQAOFUKGNGMEENWGWNWRZYHWTQC9BFMK9BLZCQGUJRRXBSNXXAHUHA	386 965
RBKSOCPFWCHXDWYVXXGAHNKP9GSXFWWWPOPMXXW9FRMW9QESWGCY9PK9UOYN9FXD9UBSPIGSGIAJPEELV	379 225
RGTTNRQBFCBSQERUXE9IHGZMDLZCP9LOCXJKWIDOCXBFDXFLDSJMTFVRNBQNCGREQJCO9NJIMDS9GSRJQ	373 879
GJCLGCCCTDRWOUPAYKAGZZZUCJUFULITSNLRMRFXESJMRRHOMPVT9NSAAPLPDKCQXE9BD9GBAHTFMSPGP	372 981
JXQVDPNKMEZVTZDBRFJYQELAIKJYBCAVIYBQAISXLEAMGVYEBN9NASUWINKOINBLSBGUQEKOTQC9GRKXV	368 390
WXZMVPOZLS9LNOSPNZHXAIFRKGWYLBZDYGEIIQYWTDEHYHRULIUBFKQSKRCVR9TKZTKTEZH9NBTXOFWLY	343 968
OUNWFZA9LKAKCFEORCWVZZYYRBLOJMYLEPJMSLEHPXCYQASWHTOFTYDKIECMISVUFTBNZCLXGSFYZOOHX	343 489
GRCUXGQRZSOCLOAHOMYEM9GIFIPAGJOJEKISNWDWXWGAYSVCLLNETKITZSNYDVAUDTBYEOJQZWPBGUJDJ	341 303
DLXCIHAFTPDXDPZMZETTNSQXD9MP9GTFOOARDEDVPOWCDZSXKSNYJ9OTXSCMMMHRM9LSRMGDDUUSXTLWQ	327 630
EXIFCWG9GO9PWOKTURW9BTSJKQPPHHUOYFKQKTHKRC9ULUIQGPQXDGXUCYTWPYBZO9BTFINOEVS9ZKUSO	319 515
YFHRWGVTTTDKVRP9AJLQZDMXNAVGWBHDSFQJMUMOYDVNPBTIZJONXRNJJKSXPYDPKVULFDCOHFUZKZYSH	296 935
DNNSFSCHMEPLEANYDK9NJNNFQZLJSOOU9LGRZUQIYP9DC9SRDZL9CVJXHQKXYKXZMNAUQHJEXVJDIZKLY	270 875
AIMKHCCCAMYRDDEYELGDYJKZJZYHXLOAISXFKEHWGXARVKBCWLXTDFKTCYJML9GTKNWPUMPQWEYFPWHLZ	265 267
YXSVPXGKUROAQEXOYNUFORCLIJWPYHQBZMFAWLQMUMAUJKGQNZYBCEUEHZXJILBEYDBFIPWZULPAYLQYU	261 715
9YBPPV9JFQDSRAMHIBKD9XVLMIKMSTHTPDY9KNUTUTLUHRCJIU9JRXNUEKDARVBCEKDCWHSESL9IUMAPF	259 460
BMYXOAWCZ9XE9IREGDF9BHGMQKEXMN9UIQ9YLREYFWIOYMKQMRQYIEIZKWCLWGVVMZBXKDPSJYISVZXDP	257 976
TMZWPWVXAPPYPCDQRJVMTAVOOCGAVTRRDFTERFYUEUPYYPVVFCEAPGBA9PPGSBKCYHGK9NCFJBOCSPQRS	257 976
BRBPHMYNLXH9EOXGPNPIBGXXKVKIXHYZQJBNAYMGEGKFXTNCUUMG9SLZRVMXIPIVMXRNTQQUOHUK9RECK	252 559
GAAMZTZHYLFQJAHWDHEK9RQGTNKXYU9SIAIUINC99LWWVSMPDNYUMMAACWKJWNHSQKUETLBNQPLX9FAXW	249 676
YLHLZIELVWTJXUEOHDUTXZXVWGOYZZVQPIDVCUOHLMZPKUYETYHTJLBF9WSZTZAIOOQGXREDDROEVPMEW	243 788
SCOUXWLWIOPHLLXAQKVMGQLHCCTQHQTQXCARVDTIUADJKGUFOKKLYEZYNUCKOMTRDXQ9CPDLSRVXHPLLM	241 152
XPIEMH9PPEVHKI9UUPIUHCUSTAIDFNDEGRWMRUDIQYKOKAHVQXPFO9SSIDESXLCNJJDHMYQ9RYPVEYOAN	241 152
RSZPPWTBWYRYMZM9MCKZUOSWXRSYMQBEJMAABCPUKVHFZOCTDPNKEMFUPVJHIRJGXR9LBFUSMYJICDJXX	235 544
NUCYRNUPAWNEXFQO9SWHJWCMCUHOV9K9FQLKOYQTEJDSSDVXXJTAPMIRRVTRTQNNBDCCTBJGPGLIWWLQN	229 337
GDODWGXYR9GNFHZALKXRMOOAP9BNOBNTXUSIVGOYBVGGUMAQ9FYYDVNFMBGUSLSRMMVSXHHVGMTOOTGBN	226 331
RBYRRBHCKLEVTNJWNACRKSDAUJSJFFFMGHOFGPQQRZRZRRJOTXIKCGJKFJLIWHZSCEUIYBQZVZDCZDVFW	224 327
D9ITMSYRRFSFHHLEFF9BYFPJFZ9OIPAHMTUDDKWUIDLNEWBQJ9EAFOJZLXGTSFCKQSPQBKUKK9KNUZLBH	223 580
M9UIWVYSSTYYHMHPSFG9MVXSS9XFVXEPXPFYOQOCRRZEINTJDMEORALUXARUZCOZSCNALHZXFRFENOXQF	214 980
NKPDTUTXXWHDVSYQIWZKTPCWGXQCIUHOXXEOQCHMBCEGEIXPFUWOZTMGXJXG9NVDWIXMVTOKAVNNMHZDM	214 980
GPLHVXQBSHTLFF9ADKZTELHXWY9GYKRKLLXYENXXXHMXRUOEMWSQMXBMZTIUWADGVFFLDGLAPVFAXUSAK	203 166
LYTUVNWUOLSWXEZEOSYRJCEOUCUNHQDVEICVHOVCWHOTCWVWCBGIVUJVVIQUEWANETGNEVEBHAWMGLWMW	186 939
YZJTDBIHYEFYJEXHVVWWZUWOMXJZRPKBFHQSMJFDXHPZCFQML9JKVH9EKWVYMSOXGMAE9KLMEJDKUKBJQ	186 790
NBNJCGEXTGMJNBVPNMGTMUCU9PXNOPDAGFEJYEMLLR9G9NPOCBZAZGMVIZKLSRKCLWDSIDVBKE9NEVQXQ	182 131
9YIHGAIPAWJYJNGJNNODL9QQNNVDCENRFGTSPHFXNNOUX9VJJBMFBQAURLARPKDEBJ9FGNGEVQHXCBZVC	179 537
KZMBUCPOXUVZPQNUGHDPEERYEHSSGSCRIBZGEJM9YCMDXZHPPGUNJFNAROJALXTEABIVIMXKVNRZRBMCF	171 984
O9EEUEFJXUOXEJSLOYEXRHAKFW9QKD9JVX9TKYBXJSXRYSCBHTUFDVSMXZLIOKWGOPJSZVXDHPIYVNSLA	171 984
YVMGDZVFIAFOBAOBLEDAY9SUDKLDEEVLICY9EGCINTMMITKJLF9NWKAWTPILZLXDJO9VSDHN9ZMICWROF	167 685
WUZFTKLICHUOVMCD9QNUXPUZWZABEXXZINKBFSHYYIQZ9BPYNKHOQXIYA9FREPBRNQYBYRMIGEOVCHCWL	160 768
PPINRNDVJDZAVSCEKNU9JWKCCKB9OPAVMJKICMUBRDT9UUNFYN9OCDXNMJEOS9FTNYPKETGDSOXWBGYSK	155 534
KIZGBXGBFEMPWVQJXGMDRLD9MPUXHBZOZMYSABKOCAYGVZGOMINRFKGVVRHMZQXDCQKFLQCMEYSSDRKDL	133 308
STVUGACMZPXYZBZMYHFERZTOUFCLHYYDRCIQVECRAGAHDDKHRYGWIEWZELPAEVYDBWVICGFGMEGJHQDSZ	120 335
FGT9GS9RMT9CHHFOTPMNWGNVWCRZMBWIQPSGIHAN9OBTGAAIUQIWRFZAKXDBDIJDJUTGXKYWGDPTDDMKZ	94 815
HCPUZMFRSL9JIGVJTDLLBZIQTLHVMQJFFG9UFEV9X9AXFTVNOFKZDBMXFGM99HLFUUXVXPMPINBSNNMCS	94 591
TZJ9JNHIHNYWMGWKOWWUUJJFWUALYMADTAZSHYNIYGVWP9EWVIPPVXWSDVWYRQFXRPGGPXOQNWZRIDWFI	94 591
UKMYAQPYSOLGXJHXZXAHCLOHDWNDRUISVZGNNOVBCDFDR9VCGKZDAESMKEEHIFTRTWNAUTEEAD9HUABLS	94 591
XHTIFGAAIHAGZQDLE9PHQIOXQNZP9EWOI9POILBRBZOFIDVTHUEYJ9ZEKTSVASKFZIC9WKLMLZPOOGVHV	89 731
NYXZFZXC9SRBUAWCENB9I9BEPVIADGKYTXPN9VTVBWGZBENTTQKT9ATROHKTMIJKNFR9SARVDREAYLFLK	85 992
SAALDBYKQITHSDSIZDHJVBHAMI9ODFJUWKNBKEQGWRWJCYMYCZXHXMUVNVLAHREUCJLVQVYSUCIQKTBCC	85 992
SYHXAZIIMW9NMEA9VJKUMRHHDMYXHNCWCZFJQOMLQAEMJRQDUJKZMVISHOTVXHIMCMPQFSNUPMXYNQCP9	85 992
WKLTBXOPYKTENLDPU99VTJNS9RGKFHROXSWRKXYOZVOVBIYSYZY9GXGT9FALSOJQSSYLGQIDLTMXGHBQO	85 992
AGNYBFGTEZWLNAIQT9WQMAFQNYFXYN9PPURYJF9UKYQL9LPULMXPMGOGAW99HKJZIZFSCIUGWIEROBOCP	81 263
CECXMDZEQQZWGTLO9HLZOSE9YCJWASAGMIQSGCHWDEYZCXWDTKBSLTFVBRNADGAYMALJBHKJURZ9STYKD	80 384
GJZQHSYBVUTYTFGN9BPPLK9L9CGTTE9HTTKFUKNMJQSQYYCVJJECBVWYJLIBMWWHIIEDZUHEGDZEPCDFH	80 384
AUCUSILSKJJJHBKIZZT9ZEBVWXPYBZDBLOWN9QRVIODMWKPAJLWZXPAFT9WCRDNIZUADNMNPZJLUDWSSY	80 304
ZNAEWTXMZMB9BNCZKXOGE9NMJDCVZLPMFJLJFIDFENVIEQIW99ICZYXDORAJ9ZMTIJHPVIZRHFCAWJJJO	77 393
RVGSUDUTOEYLQEPDVFACIZ9CUJETUZ9EFI9EYBZMSNMNHVQTTHFWC99NBJMBJEUSQWEDORRWYODYWQXXP	74 776
WYPBSBBSAWMBLSGIQATAKCSWJGBLPJ9OTTFNKAEQA9FZXVS9TXPKOILLYPHAQHAPVAUDR9INYFDGQZRMC	74 383
FDTOXHTCMNLXZE9UCUZ9YCMPFRDXSSDSPXSRCGFLWZAXWHVH9CXKJUZACGOLNJUIYJFUEINEQKJAOI9TC	74 171
WKRCSTWLAXBPEESWUQXNIYXEXUQQMDPLWWSPU9OBEX9GCIQHUNXUNIEN9AKBBLHIV9DPGZIIVGYFHNKMI	58 761
QITATJIEHYXHUVOOWYBVGBFGWHHVMIOLE9OW9DZYGTYIBTVWFFIHRUDSYAKPFTSTMBHNJLKTXN9KHBSIZ	56 269
BOHIYEBPXEZUREVUAJUKYTAC9LU9DCPM9EPNECARZALVFPIEYIORQMWLJFBBWCVPIJKAHYUTQIEVBQPIJ	48 824
IANQAELBICM9RTVG9HLPFPWDP9WTVCWWVOIG9AKYMQAXCMHLHCSROALBGCWSYESDPEGSNIKSG9HLFCDTJ	42 996
IYHAHAVBLUUNKAQFVDHQNKTZNEVEYVGR9IITFIAZSHBQIQMM9FCKPIGEIWAVOWGD9LSQYJORTZTJOWSYY	42 996
SBVHJIJDGYTNZWETQPJCGHWCQEGGSX9REFPUFLCO9VZFGENVWHZLLAFSSOAZRKJOMBPDRVPPRDNEMOCGG	42 996
FPREWAMSNJXUFSAVXGZ99KPE9EGJCVLTHDDKNBDVU9NTDCBWT9BDYZZOMMLJOQURDCNO9JYVRDFLODANH	29 910
CNUDZBUYMZTL9VHHQNXIBRUPGJEEVCLHPDZOOJR9SXWNEMJPOVPAPYLJLHXPAAQHKXHTPLCILDGUGZZIQ	21 498
VEAJXXFSAJQEHARIRLOYGQAVSBDRPDRNVMW9NVJK9OEWRF9TOSXEYTUFPCCFJVTOFKSGTSWISATTXM9AL	16 077
VYYMYN9DYDGJPZBKDTZQSTX9GPRFJWBCSTFZZPOIK9UZ9EANZIEDKSFWUYBUJCXKDR9AGBEABCKGAEYWB	9 459
DMCEYDFCZPODTDQXIAYXPD9QIRVBOKJUOEVIOJIJLRNRROAXWQGNMGOMBFKBPUECCXDTFQBIZTPOZAFUD	8 599
QEQHSIOJHSGLELWZCIXMLWQUXKLUOKZOOHTKTLZHGVACXUUELIRKGXMTHYKVLXQYBZTAVBHW9UHISQRXI	4 487
9OVEELYGC9ODPWMQCCVJOCAHRDDLDLAIVEIQD9RHIXZWIEPTLFZUXCUGACUB9YHJ9HSNUYQAUFQNRAYZN	3 055
PX9PSQPVTMLTPILEWGO9FHXALFLALAFUDDSCYKAOYYXQDPMJYEV9MEKSKIBPGEYQLAIFFCRJXLNVYWERP	2 412
VP9HLYMWTU9N9WFIVSCJEXRUNOKM9T9ROXKM9DLUELPRDUFVMPZZAEPMBVBUOQPOAEHKSGCSYWEAETIAO	1 939
YICKYEYPTEEW9LX9YHSEZFBETZHESXHKOLDDFAV9SUZCFMMSLPA9GSQPEETQFHQJGZUB9WSACCRZJZKQI	1 122
Unclaimed Iotas Fund (50+ entities)	101 193 118

#22

En el post anterior la lista de direcciones del bloque génesis con sus respectivos IOTA.

https://bitcointalk.org/index.php?topic=1262688.msg13628833#msg13628833


#23

Enlace descarga Iota 0.0.1
https://s3-us-west-1.amazonaws.com/contattafiles/iota/4QXZIs9y6yRxyK6/Iota-0.0.1.zip

Cómo montar un nodo de IOTA, guía para novatos:







#24

Tiene algún tipo de reward tener un nodo?


#25

Económicamente cómo la minería, no. Aquí no hay blockchain, es un concepto diferente. Simplemente ayudas a mejorar la red y tener mayor seguridad. Las transacciones serán gratis.

El coste de un nodo montado siguiendo la guía es de 9.6$ al mes (primer mes gratis para nuevos usuarios).

Ya tengo mi nodo, si alguien monta uno y quiere que nos añadamos las IPs a la lista de nodos, que me envíe privado.

Por ahora esto es para ir construyendo la topología de la red. En Ryver ha puesto CFB que con unos 10 nodos bastaría para el siguiente paso, pero por el movimiento que ha habido desde ayer, habrá ya unos cuantos más :grinning: